General Information

  • ID:  hor006662
  • Uniprot ID:  Q27225
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  MIH
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD
  • Length:  78(36-113)
  • Propeptide:  MMSRANSRFSCQRTWLLSVVVLAALWSFGVHRAAARVINDECPNLIGNRDLYKKVEWICEDCSNIFRKTGMASLCRRNCFFNEDFVWCVHATERSEELRDLEEWVGILGAGRD
  • Signal peptide:  MMSRANSRFSCQRTWLLSVVVLAALWSFGVHRAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-Q27225-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006662_AF2.pdbhor006662_ESM.pdb

Physical Information

Mass: 1056003 Formula: C398H616N116O121S7
Absent amino acids: Q Common amino acids: ER
pI: 4.64 Basic residues: 12
Polar residues: 23 Hydrophobic residues: 26
Hydrophobicity: -46.15 Boman Index: -19621
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 77.44
Instability Index: 4914.74 Extinction Coefficient cystines: 18365
Absorbance 280nm: 238.51

Literature

  • PubMed ID:  8224217
  • Title:  Molecular cloning of crustacean putative molt-inhibiting hormone (MIH) precursor.
  • PubMed ID:  1679945
  • Title:  Amino acid sequence of putative moult-inhibiting hormone from the crab Carcinus maenas.